PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_9.75
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family bZIP
Protein Properties Length: 158aa    MW: 17862.6 Da    PI: 9.6945
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_9.75genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1292.3e-092576455
                                XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                      bZIP_1  4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55
                                 kr +r+ +NRe+ArrsR+R++++ie L ++++ L  + ++  k+ + + + 
  evm.model.supercontig_9.75 25 EKRRKRMLSNRESARRSRLRRQKQIEDLVNEIALLNRKIQEGNKRFDIIMES 76
                                59*******************************9988766555555555555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.0E-92286IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.6E-62497No hitNo description
PROSITE profilePS502179.4612487IPR004827Basic-leucine zipper domain
PfamPF001708.6E-82683IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.75E-82678No hitNo description
CDDcd147021.90E-122775No hitNo description
PROSITE patternPS0003602944IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006521Biological Processregulation of cellular amino acid metabolic process
GO:0009267Biological Processcellular response to starvation
GO:0009617Biological Processresponse to bacterium
GO:0009651Biological Processresponse to salt stress
GO:0009901Biological Processanther dehiscence
GO:0010182Biological Processsugar mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MVKQGIQLTN SVLEKDARYA VITDEKRRKR MLSNRESARR SRLRRQKQIE DLVNEIALLN  60
RKIQEGNKRF DIIMESNKAV ESENNVLRAE KTRLANYMFH LEIMILNSCM QVGSSSVAGC  120
SCDGQSSEKM ASPELCRVPW QVGGATQPII SPGIFEF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM125812231
Representative plantOGRP1379334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49450.14e-18basic leucine-zipper 1